Property Summary

NCBI Gene PubMed Count 56
PubMed Score 149.82
PubTator Score 34.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis 1.003 3.6e-02
breast carcinoma -1.100 6.7e-04
ductal carcinoma in situ -1.500 9.3e-04
fibroadenoma -1.400 2.0e-02
glioblastoma 1.300 1.2e-02
invasive ductal carcinoma -1.300 1.1e-02
lung adenocarcinoma -1.300 6.3e-14
lung carcinoma -2.200 1.5e-23
non-small cell lung cancer -1.515 1.1e-17
ovarian cancer -2.100 4.5e-10
pancreatic cancer 1.100 2.6e-04
pediatric high grade glioma 1.200 1.4e-03
primary pancreatic ductal adenocarcinoma 1.607 9.7e-03
tuberculosis 2.800 2.2e-09

Gene RIF (29)

AA Sequence

MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC      1 - 70
SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV     71 - 140
GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG    141 - 210
GGCPCVLL                                                                  211 - 218
//

Text Mined References (59)

PMID Year Title