Property Summary

NCBI Gene PubMed Count 54
Grant Count 94
R01 Count 47
Funding $8,295,182.55
PubMed Score 144.32
PubTator Score 34.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
glioblastoma 1.300 0.012
tuberculosis 2.800 0.000
primary pancreatic ductal adenocarcinoma 1.607 0.010
non-small cell lung cancer -1.515 0.000
active ulcerative colitis 1.003 0.036
pancreatic cancer 1.400 0.015
breast carcinoma -1.100 0.001
fibroadenoma -1.400 0.020
lung adenocarcinoma -1.500 0.000
pediatric high grade glioma 1.200 0.001
lung carcinoma -2.200 0.000
ductal carcinoma in situ -1.500 0.001
invasive ductal carcinoma -1.300 0.011
ovarian cancer -2.100 0.000

Synonym

Accession P10301 Q6FH12
Symbols

Gene

PDB

2FN4  

Gene RIF (27)

PMID Text
27029009 Suggest that R-Ras regulates angiogenic activities of endothelial cells in part via inhibition of the p38MAPK-HSP27 axis of VEGF signaling.
26381333 RRAS is a key regulator of miR-34/449 promotion of actin network formation during multiciliogenesis.
25869066 Girdin regulates the trafficking of VE-cadherin in synergy with R-Ras.
25447204 phosphorylation of ORP3 controls its association with VAPA. Furthermore, ORP3-VAPA complexes stimulate R-Ras signaling.
25192052 Patients with gemistocytic astrocytomas with an RRAS deletion tend to have shorter survival rates than those without deletion.
24705357 Evidence is provided of a functional link between RRAS and MAPK signalling and reveal an unpredicted role of enhanced RRAS function in human disease.
24700169 Contradicting the positive association reported in previous studies, our results indicate that R-Ras activation may negatively regulate the transformation of breast epithelial cells.
24131527 A polymorphism linked to RRAS, SCAF1, IRF3 and BCL2L12 genes is associated with cirrhosis in hepatitis C virus carriers.
23209424 These data suggest that pharmacological inhibition of RRAS signaling may confer therapeutic benefit in Huntington's disease.
22897853 These findings identify R-Ras as a critical regulator of vessel integrity and function during tumor vascularization.
More...

AA Sequence

MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKIC      1 - 70
SVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLV     71 - 140
GNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKG    141 - 210
GGCPCVLL                                                                  211 - 218
//

Text Mined References (57)

PMID Year Title
27029009 2015 R-Ras Inhibits VEGF-Induced p38MAPK Activation and HSP27 Phosphorylation in Endothelial Cells.
26381333 2015 miR-34/449 control apical actin network formation during multiciliogenesis through small GTPase pathways.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25869066 2015 Girdin/GIV regulates transendothelial permeability by controlling VE-cadherin trafficking through the small GTPase, R-Ras.
25447204 2015 OSBP-related protein 3 (ORP3) coupling with VAMP-associated protein A regulates R-Ras activity.
25192052 2014 Alterations of the RRAS and ERCC1 genes at 19q13 in gemistocytic astrocytomas.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24705357 2014 Activating mutations in RRAS underlie a phenotype within the RASopathy spectrum and contribute to leukaemogenesis.
24700169 2014 Negative association of R-Ras activation and breast cancer development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...