Property Summary

Ligand Count 66
NCBI Gene PubMed Count 307
PubMed Score 919.31
PubTator Score 1059.89

Knowledge Summary

Patent (71,249)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 5.505 2.8
Disease Target Count Z-score Confidence
Peanut allergy 11 4.424 2.2
Cleft Lip 141 3.568 1.8
Cleft Palate 271 3.219 1.6
Disease Target Count
Acute Promyelocytic Leukemia 40

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 2.500 1.7e-02
Astrocytoma, Pilocytic 1.400 1.5e-06
atypical teratoid/rhabdoid tumor 1.500 3.8e-02
gastric cancer -1.200 2.5e-03
glioblastoma 2.400 4.4e-02
group 3 medulloblastoma 1.100 2.5e-02
non primary Sjogren syndrome sicca 1.100 1.5e-02
osteosarcoma 1.292 1.7e-04
pituitary cancer -1.200 8.2e-06
posterior fossa group A ependymoma 1.200 9.0e-07
primitive neuroectodermal tumor 1.200 2.2e-03
psoriasis -1.100 3.6e-12
tuberculosis -1.100 1.5e-04
type 2 diabetes 1.336 7.8e-03

Protein-protein Interaction (3)

Gene RIF (201)

AA Sequence

MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEE      1 - 70
IVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRC     71 - 140
QYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTT    141 - 210
NNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPE    211 - 280
QDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDM    281 - 350
LQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL    351 - 420
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP                                421 - 462
//

Text Mined References (311)

PMID Year Title