Property Summary

NCBI Gene PubMed Count 290
Grant Count 775
R01 Count 489
Funding $70,893,670.3
PubMed Score 890.62
PubTator Score 1059.89

Knowledge Summary

Patent (71,249)

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer -1.200 0.003
osteosarcoma 1.292 0.000
glioblastoma 2.400 0.044
primitive neuroectodermal tumor 1.200 0.002
type 2 diabetes 1.336 0.008
tuberculosis -1.100 0.000
adult high grade glioma 2.500 0.017
atypical teratoid/rhabdoid tumor 1.500 0.038
group 4 medulloblastoma 2.500 0.048
pilocytic astrocytoma 1.400 0.000
posterior fossa group A ependymoma 1.200 0.000
non primary Sjogren syndrome sicca 1.100 0.015
psoriasis -1.100 0.000
pituitary cancer -1.200 0.000

Synonym

Accession P10276 B8Y636 P78456 Q13440 Q13441 Q96S41 Q9NQS0 RAR-alpha
Symbols RAR
NR1B1

Gene

PDB

3KMZ   1DKF   1DSZ   3A9E   3KMR   4DQM   5K13  

  TechDev Info (2)

Michael McManus Genetic interaction screen
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (188)

PMID Text
27052408 Data suggest that hematopoietically expressed homeobox protein (HHEX) downmodulation by promyelocytic leukemia-retinoic acid receptor alpha fusion oncoprotein (PML-RARalpha) is a key event during acute promyelocytic leukemia (APL) pathogenesis.
27030546 Suggest a novel role of PCGF2 in arsenic trioxide-mediated degradation of PML-RARA that PCGF2 might act as a negative regulator of UBE2I via direct interaction.
26969398 down-regulation of the level of RAR alpha leads to increased expression of VDR in acute myeloid leukemia.
26728137 ATRA dramatically down regulated RARalpha protein levels and led to more DNA damage and ultimately resulted in the synergism of these two agents
26537301 Novel insight into the functional difference of acquired mutations of PML-RARA both in vitro and in the clinical setting.
26469385 HIV-1 MA upregulates RARA gene expression in HepG2 cells
26294332 The PML-region mutations were associated with response to Arsenic trioxide-based therapy (P < 0.0001), number of relapses (P = 0.001), and early relapse (P = 0.013)in acute promyelocytic leukemia patients.
26213848 Methylated arsenic metabolites bind to PML protein but do not induce cellular differentiation and PML-RARalpha protein degradation in acute promyelocytic leukemia.
26088929 our findings challenge the predominant model in the field and we propose that PML/RARA initiates leukemia by subtly shifting cell fate decisions within the promyelocyte compartment.
26041820 Data show that the tumor suppressor RASSF1A is a direct target of the PML/RARalpha-regulated microRNAs miR-181a/b cluster.
More...

AA Sequence

MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEE      1 - 70
IVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRC     71 - 140
QYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTT    141 - 210
NNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPE    211 - 280
QDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDM    281 - 350
LQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL    351 - 420
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP                                421 - 462
//

Text Mined References (294)

PMID Year Title
27052408 2016 PML-RAR alpha induces the downmodulation of HHEX: a key event responsible for the induction of an angiogenetic response.
27030546 2016 PCGF2 negatively regulates arsenic trioxide-induced PML-RARA protein degradation via UBE2I inhibition in NB4 cells.
26969398 2016 Regulation of vitamin D receptor expression by retinoic acid receptor alpha in acute myeloid leukemia cells.
26728137 2016 All-trans retinoic acid synergizes with topotecan to suppress AML cells via promoting RAR?-mediated DNA damage.
26537301 2016 Varying responses of PML-RARA with different genetic mutations to arsenic trioxide.
26294332 2015 Evaluating frequency of PML-RARA mutations and conferring resistance to arsenic trioxide-based therapy in relapsed acute promyelocytic leukemia patients.
26213848 2015 Methylated arsenic metabolites bind to PML protein but do not induce cellular differentiation and PML-RAR? protein degradation.
26088929 2015 Transcription and methylation analyses of preleukemic promyelocytes indicate a dual role for PML/RARA in leukemia initiation.
26041820 2015 PML/RAR?-Regulated miR-181a/b Cluster Targets the Tumor Suppressor RASSF1A in Acute Promyelocytic Leukemia.
26026090 2015 Bortezomib Causes ER Stress-related Death of Acute Promyelocytic Leukemia Cells Through Excessive Accumulation of PML-RARA.
More...