Property Summary

NCBI Gene PubMed Count 1,797
PubMed Score 6683.73
PubTator Score 7221.94

Knowledge Summary

Patent (193,439)

TINX Plot

  Disease Sources (10)

Disease Target Count P-value
glioblastoma multiforme 347 1.53882712756606E-17
psoriasis 6685 1.35957707918179E-16
malignant mesothelioma 3163 3.76588488852162E-8
posterior fossa group A ependymoma 1511 5.48756376770163E-8
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.72391407658943E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 7.7347608624123E-6
interstitial cystitis 2299 1.90862589135466E-5
atypical teratoid / rhabdoid tumor 4369 4.2742368113688E-5
group 4 medulloblastoma 1875 6.65174495343218E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.90936491879506E-5
primitive neuroectodermal tumor 3031 0.00114826934152207
Atopic dermatitis 944 0.00122450670384098
medulloblastoma, large-cell 6234 0.00198804367460336
astrocytic glioma 2241 0.00430757800724481
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00526420097120403
cutaneous lupus erythematosus 1056 0.00750589409769529
osteosarcoma 7933 0.0104855189971975
pituitary cancer 1972 0.0151668811520883
Disease Target Count Z-score Confidence
Carcinoma 2147 4.804 2.4
Disease Target Count Z-score Confidence
Prostate cancer 172 8.057 4.0
Alopecia universalis 10 0.0 2.0
Disease Target Count Z-score Confidence
Kennedy's disease 13 7.484 3.7
Androgenic alopecia 10 4.923 2.5
Disease Target Count Z-score Confidence
Pseudohermaphroditism 16 4.091 2.0
Neurodegenerative disease 383 0.0 4.0

Expression

Synonym

Accession P10275 A0A0B4J1T2 A2RUN2 B1AKD7 C0JKD3 C0JKD4 E7EVX6 Q9UD95
Symbols KD
AIS
AR8
TFM
DHTR
SBMA
HYSP1
NR3C4
SMAX1
HUMARA

Gene

AR

PDB

3L3X   3L3Z   1T5Z   4OED   4OH6   4OKB   1E3G   1GS4   1T63   1T65   1XJ7   1XOW   1XQ3   1Z95   2AM9   2AMA   2AMB   2AO6   2AX6   2AX7   2AX8   2AX9   2AXA   2HVC   2OZ7   2PIO   2PIP   2PIQ   2PIR   2PIT   2PIU   2PIV   2PIW   2PIX   2PKL   2PNU   2Q7I   2Q7J   2Q7K   2Q7L   2YHD   2YLO   2YLP   2YLQ   2Z4J   3B5R   3B65   3B66   3B67   3B68   3BTR   3RLJ   3RLL   3V49   3V4A   3ZQT   4HLW   4K7A   4OEA   4OEY   4OEZ   4OFR   4OFU   4OGH   4OH5   4OHA   4OIL   4OIU   4OJ9   4OJB   4OK1   4OKT   4OKW   4OKX   4OLM   4QL8   5CJ6  

  Ortholog (8)

 GWAS Trait (1)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)
More...

Gene RIF (1628)

PMID Text
27522732 Increased frequency of CAG repetitions of Androgen receptor gene was directly proportional to the level of psychological development, social adaptation and professional activity but inversely proportional to the masculine sexual traits.
26986969 Data show that the down-regulation of androgen receptor protein by tocopherylquinone (TQ) was abrogated by co-treatment with antioxidants.
26928463 AR activity was inversely associated with cell proliferation, whereas the expression of Fa complex genes was correlated with elevated cell cycle progression, expression of the E2F transcription factor 1 (E2F1) and loss of RB1.
26928323 AR expression was higher in radical prostatectomy-prostate cancer and radical prostatectomy-benign samples than in benign cystoprostatectomy samples.
26910733 The correlation between the number of CAG triplets in androgen receptor and hyperactivity symptoms in boys with autism spectrum disorders
26862755 When a human AR transgene is conditionally expressed in bladder urothelium, male and female transgenic mice have a higher incidence of N-butyl-N-(4-hydroxybutyl)- nitrosamine-induced urothelial cell carcinoma than age and sex matched control littermates.
26848581 The Presence of Clitoromegaly in the Nonclassical Form of 21-Hydroxylase Deficiency Could Be Partially Modulated by the CAG Polymorphic Tract of the Androgen Receptor Gene
26813233 This work demonstrates the feasibility of a prognostic and/or diagnostic platform combining the direct identification of AR mutants from patients' serum in order to provide personalized recommendations regarding the best future therapy.
26808578 Functional analysis revealed that miR-34c and miR-297 overexpression down-regulated AR expression and inhibited the expression of downstream AR targets and that PlncRNA-1 overexpression rescued these effects.
26805759 By suppressing AR and up-regulating ULBP2 in HCC, cisplatin could up-regulate cytotoxicity of NK cells to better target HCC.
More...

AA Sequence

MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQ      1 - 70
QQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVA     71 - 140
ASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGR    141 - 210
AREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVR    211 - 280
PTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKS    281 - 350
GALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA    351 - 420
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGL    421 - 490
AGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTC    491 - 560
LICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGAR    561 - 630
KLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAA    631 - 700
LLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLV    701 - 770
FNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD    771 - 840
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSG    841 - 910
KVKPIYFHTQ                                                                911 - 920
//

Text Mined References (1820)

PMID Year Title
27522732 2016 [COMPREHENSIVE DIAGNOSTICS IN PATIENTS WITH GENOTYPE 47,XXY KLINEFELTER SYNDROME].
26986969 2016 Antioxidants Abrogate Alpha-Tocopherylquinone-Mediated Down-Regulation of the Androgen Receptor in Androgen-Responsive Prostate Cancer Cells.
26928463 2016 Substantial interindividual and limited intraindividual genomic diversity among tumors from men with metastatic prostate cancer.
26928323 2016 Global expression of AMACR transcripts predicts risk for prostate cancer - a systematic comparison of AMACR protein and mRNA expression in cancerous and noncancerous prostate.
26910733 2016 Testosterone and Androgen Receptor Sensitivity in Relation to Hyperactivity Symptoms in Boys with Autism Spectrum Disorders.
26862755 2016 Conditional Expression of the Androgen Receptor Increases Susceptibility of Bladder Cancer in Mice.
26848581 2016 The Presence of Clitoromegaly in the Nonclassical Form of 21-Hydroxylase Deficiency Could Be Partially Modulated by the CAG Polymorphic Tract of the Androgen Receptor Gene.
26813233 2016 Functional analysis of androgen receptor mutations that confer anti-androgen resistance identified in circulating cell-free DNA from prostate cancer patients.
26808578 2016 A feed-forward regulatory loop between androgen receptor and PlncRNA-1 promotes prostate cancer progression.
26805759 2016 Cisplatin enhances NK cells immunotherapy efficacy to suppress HCC progression via altering the androgen receptor (AR)-ULBP2 signals.
More...