Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

WASQVSENRPVCKAIIQGKQFEGLVDTGADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSMEILHC      1 - 70
LGPDNQESTVQPMITSIPLNLWGRDLLQQWGAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKVP     71 - 140
VEAKINQEREGIGYPF                                                          141 - 156
//

Text Mined References (14)

PMID Year Title