Property Summary

Ligand Count 16
NCBI Gene PubMed Count 113
PubMed Score 1217.38
PubTator Score 664.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 3.3e-07
tuberculosis 2010 4.1e-07
ovarian cancer 8520 4.6e-06
malignant mesothelioma 3232 1.0e-05
glioblastoma 5792 1.7e-03
adult high grade glioma 3801 2.2e-03
breast carcinoma 1638 3.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Glycogen storage disease II 6 0.0 5.0
Disease Target Count Z-score Confidence
Glycogen storage disease 39 7.715 3.9
Disease Target Count
Glycogen Storage Disease 2 1

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 2.2e-03
Astrocytoma, Pilocytic 1.100 3.3e-07
breast carcinoma 1.600 3.9e-03
glioblastoma 1.100 1.7e-03
malignant mesothelioma -1.100 1.0e-05
ovarian cancer 1.100 4.6e-06
tuberculosis 1.300 4.1e-07

Gene RIF (91)

AA Sequence

MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQA      1 - 70
HPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLEN     71 - 140
LSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYS    141 - 210
VEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWN    211 - 280
RDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSV    281 - 350
VQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG    351 - 420
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDF    421 - 490
TNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICAS    491 - 560
SHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPE    561 - 630
ILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALT    631 - 700
LRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLG    701 - 770
TWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP    771 - 840
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVA    841 - 910
TAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC                                911 - 952
//

Text Mined References (123)

PMID Year Title