Property Summary

NCBI Gene PubMed Count 79
Grant Count 66
R01 Count 24
Funding $7,542,711.35
PubMed Score 159.28
PubTator Score 125.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 2.700 0.000
psoriasis 1.800 0.000
medulloblastoma, large-cell 1.300 0.000
non-small cell lung cancer 1.890 0.000
lung adenocarcinoma 1.400 0.000
sonic hedgehog group medulloblastoma 1.300 0.001
Breast cancer 1.500 0.000
invasive ductal carcinoma 1.100 0.003

Synonym

Accession P10244 B2RBS5 B7Z8D9 F8W6N6 Q53F07 B-Myb
Symbols BMYB
B-MYB

Gene

 GO Component (2)

Gene RIF (42)

PMID Text
26308378 Data indicate that gene expression alterations in endometrial carcinoma samples with high ATAD2 expression showed upregulation of several cancer-related genes including B-MYB gene.
25502082 We found that B-Myb upregulated expression of the key epithelial-to-mesenchymal transition regulator snail and that it mediated epithelial-to-mesenchymal transition activation and cell invasion by B-Myb.
25337223 Suggest B-myb had critical roles in both cell cycle progression and tumorigenesis in breast cancer.
24515894 B-Myb plays a role in suppression of keratinocyte differentiation and maintenance of the undifferentiated proliferative phenotype by modulating the expression levels of cell cycle regulatory proteins, expressed in the S and G2/M phases of the cell cycle
24199710 MYBL2 expression analysis could be useful to define subgroups of patients with poor prognosis.
24141769 Results show that E7 interacts with the B-Myb, FoxM1 and LIN9 components of this activator complex, leading to cooperative transcriptional activation of mitotic genes in primary cells and E7 recruitment to the corresponding promoters.
23878725 conclude that downregulation of MYBL2 activity below levels predicted by classical haploinsufficiency underlies the clonal expansion of hematopoietic progenitors in a large fraction of human myeloid malignancies
23555285 MALAT1-depleted cells display reduced expression of B-MYB (Mybl2), an oncogenic transcription factor involved in G2/M progression, due to altered binding of splicing factors on B-MYB pre-mRNA and aberrant alternative splicing
23032261 A novel role for B-Myb in S-phase that appears to be independent of its sequence-specific DNA-binding activity and its ability to stimulate the expression of bona fide B-Myb target genes.
22910183 Low MYBL2 expression is associated with haematopoietic neoplasia.
More...

AA Sequence

MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASHFPNRTDQQCQ      1 - 70
YRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSCWTE     71 - 140
EEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTIKRKVDTGGFLSESKDCKPPVYLLLELEDKD    141 - 210
GLQSAQPTEGQGSLLTNWPSVPPTIKEEENSEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQE    211 - 280
GSPPETSLPYKWVVEAANLLIPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQAS    281 - 350
HQQQVLPPRQPSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL    351 - 420
SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLH    421 - 490
RDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIE    491 - 560
DDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSLSLPTTAPSNSSSLTLSGIKEDNSL    561 - 630
LNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS    631 - 700
//

Text Mined References (88)

PMID Year Title
26308378 2015 ATAD2 overexpression links to enrichment of B-MYB-translational signatures and development of aggressive endometrial carcinoma.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25502082 2015 B-Myb regulates snail expression to promote epithelial-to-mesenchymal transition and invasion of breast cancer cell.
25337223 2014 B-myb is a gene implicated in cell cycle and proliferation of breast cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24515894 2014 B-Myb enhances proliferation and suppresses differentiation of keratinocytes in three-dimensional cell culture.
24199710 2013 Adverse prognostic value of MYBL2 overexpression and association with microRNA-30 family in acute myeloid leukemia patients.
24141769 2014 A functional interaction of E7 with B-Myb-MuvB complex promotes acute cooperative transcriptional activation of both S- and M-phase genes. (129 c).
23878725 2013 MYBL2 is a sub-haploinsufficient tumor suppressor gene in myeloid malignancy.
23555285 2013 Long noncoding RNA MALAT1 controls cell cycle progression by regulating the expression of oncogenic transcription factor B-MYB.
More...