Property Summary

NCBI Gene PubMed Count 10
Grant Count 24
R01 Count 17
Funding $1,435,462.84
PubMed Score 99.36
PubTator Score 38.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (3)

PMID Text
26631609 Our study defines new molecular subclasses of ACC characterized by MYBL1 rearrangements and 5'-NFIB gene fusions.
25940947 Thus, the LIMD1-MYBL1 Index had considerable clinical value for DLBCL subtype classification and prognosis.
23633565 analysis of genetic alterations in MYBL1 in diffuse pediatric low-grade gliomas

AA Sequence

MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLVEQHGTDDWTLIASHLQNRSD      1 - 70
FQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSLIAKHLKGRIGKQCRERWHNHLNPEVKKS     71 - 140
SWTEEEDRIIYEAHKRLGNRWAEIAKLLPGRTDNSIKNHWNSTMRRKVEQEGYLQDGIKSERSSSKLQHK    141 - 210
PCAAMDHMQTQNQFYIPVQIPGYQYVSPEGNCIEHVQPTSAFIQQPFIDEDPDKEKKIKELEMLLMSAEN    211 - 280
EVRRKRIPSQPGSFSSWSGSFLMDDNMSNTLNSLDEHTSEFYSMDENQPVSAQQNSPTKFLAVEANAVLS    281 - 350
SLQTIPEFAETLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKN    351 - 420
TCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGNMALKHTPLKTLPFSPSQ    421 - 490
FFNTCPGNEQLNIENPSFTSTPICGQKALITTPLHKETTPKDQKENVGFRTPTIRRSILGTTPRTPTPFK    491 - 560
NALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLKEEDEPAYKSCKQENTASGKKVRKSLVLD    561 - 630
NWEKEESGTQLLTEDISDMQSENRFTTSLLMIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTS    631 - 700
KVVKLEKNLQSNCEWETVVYGKTEDQLIMTEQARRYLSTYTATSSTSRALIL                      701 - 752
//

Text Mined References (16)

PMID Year Title
26631609 2016 Novel MYBL1 Gene Rearrangements with Recurrent MYBL1-NFIB Fusions in Salivary Adenoid Cystic Carcinomas Lacking t(6;9) Translocations.
25940947 2015 Identification and validation of a two-gene expression index for subtype classification and prognosis in Diffuse Large B-Cell Lymphoma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23633565 2013 Genomic analysis of diffuse pediatric low-grade gliomas identifies recurrent oncogenic truncating rearrangements in the transcription factor MYBL1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...