Property Summary

NCBI Gene PubMed Count 11
PubMed Score 104.72
PubTator Score 38.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 3.425 2.5e-10
adult high grade glioma -1.300 2.1e-03
Breast cancer 1.400 3.6e-02
breast carcinoma 1.400 6.7e-16
cutaneous lupus erythematosus 1.200 1.7e-02
glioblastoma -1.200 4.5e-04
group 3 medulloblastoma 1.100 1.6e-02
head and neck cancer -1.400 2.4e-02
intraductal papillary-mucinous neoplasm ... 1.800 5.1e-03
juvenile dermatomyositis -1.289 1.1e-12
lung cancer -1.700 6.3e-03
lung carcinoma -1.800 1.3e-14
medulloblastoma, large-cell -1.200 2.1e-03
non primary Sjogren syndrome sicca 1.100 1.3e-02
oligodendroglioma 1.200 3.5e-06
ovarian cancer 1.200 3.2e-03
primitive neuroectodermal tumor 1.100 1.2e-02
sarcoidosis 1.300 8.9e-03
tuberculosis 1.700 4.1e-05

Protein-protein Interaction (5)

Gene RIF (4)

AA Sequence

MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLVEQHGTDDWTLIASHLQNRSD      1 - 70
FQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSLIAKHLKGRIGKQCRERWHNHLNPEVKKS     71 - 140
SWTEEEDRIIYEAHKRLGNRWAEIAKLLPGRTDNSIKNHWNSTMRRKVEQEGYLQDGIKSERSSSKLQHK    141 - 210
PCAAMDHMQTQNQFYIPVQIPGYQYVSPEGNCIEHVQPTSAFIQQPFIDEDPDKEKKIKELEMLLMSAEN    211 - 280
EVRRKRIPSQPGSFSSWSGSFLMDDNMSNTLNSLDEHTSEFYSMDENQPVSAQQNSPTKFLAVEANAVLS    281 - 350
SLQTIPEFAETLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKN    351 - 420
TCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGNMALKHTPLKTLPFSPSQ    421 - 490
FFNTCPGNEQLNIENPSFTSTPICGQKALITTPLHKETTPKDQKENVGFRTPTIRRSILGTTPRTPTPFK    491 - 560
NALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLKEEDEPAYKSCKQENTASGKKVRKSLVLD    561 - 630
NWEKEESGTQLLTEDISDMQSENRFTTSLLMIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTS    631 - 700
KVVKLEKNLQSNCEWETVVYGKTEDQLIMTEQARRYLSTYTATSSTSRALIL                      701 - 752
//

Text Mined References (18)

PMID Year Title