Property Summary

NCBI Gene PubMed Count 10
PubMed Score 132.49
PubTator Score 10450.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.100 2.9e-06
lung cancer 1.200 1.7e-03
Multiple myeloma 1.539 4.8e-05
ovarian cancer 1.400 6.7e-05
psoriasis -1.200 1.9e-03

Gene RIF (3)

AA Sequence

MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE       1 - 69
//

Text Mined References (10)

PMID Year Title