Property Summary

NCBI Gene PubMed Count 10
Grant Count 32
R01 Count 22
Funding $2,472,611.19
PubMed Score 127.09
PubTator Score 10450.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.539 0.000
psoriasis -1.200 0.002
lung cancer 1.200 0.002
ovarian cancer 1.400 0.000
Breast cancer 1.100 0.000

Gene RIF (3)

PMID Text
26685157 COX8A is indispensable for function of human complex IV and its mutation causes Leigh-like syndrome and epilepsy.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE       1 - 69
//

Text Mined References (10)

PMID Year Title
26685157 2016 Loss of the smallest subunit of cytochrome c oxidase, COX8A, causes Leigh-like syndrome and epilepsy.
25416956 2014 A proteome-scale map of the human interactome network.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12909344 2003 A third isoform of cytochrome c oxidase subunit VIII is present in mammals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10637443 1999 Peptide nucleic acid delivery to human mitochondria.
2847943 1988 Human heart cytochrome c oxidase subunit VIII. Purification and determination of the complete amino acid sequence.
2543673 1989 A gene specifying subunit VIII of human cytochrome c oxidase is localized to chromosome 11 and is expressed in both muscle and non-muscle tissues.