Property Summary

NCBI Gene PubMed Count 58
Grant Count 47
R01 Count 22
Funding $3,079,000.2
PubMed Score 313.39
PubTator Score 299.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer -1.200 0.001
Waldenstrons macroglobulinemia 4.362 0.001
osteosarcoma -7.371 0.000
posterior fossa group A ependymoma 1.700 0.000
glioblastoma 2.400 0.001
tuberculosis 3.100 0.000
colon cancer -2.100 0.000
interstitial cystitis 1.100 0.036
adult high grade glioma 1.800 0.000
group 3 medulloblastoma -1.300 0.005
pilocytic astrocytoma 2.000 0.000
psoriasis 1.600 0.000

Gene RIF (29)

PMID Text
26534742 Serum EDN level may be a useful marker for monitoring persistent airflow limitation in adult patients with asthma who had positive results for house-dust-specific IgE antibodies.
25221852 RNASE2 gene expression was differentially expressed in rheumatoid arthritis patients considering a sequence polymorphism.
24890227 increased in feces after the ingestion of enterocolitis-causative foods
24814827 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation.
23533305 A higher level of serum EDN was found specifically in patients with ALS, indicating that EDN may participate in the pathophysiology of Amyotrophic lateral sclerosis.
23053729 findings show substantial amounts of EPX/EDN localise in an extra-granular, low equilibrium density compartment of eosinophils
21680952 Eosinophil protein X in urine from asymptomatic neonates is a biomarker significantly associated with later development of allergic sensitization, nasal eosinophilia, and eczema during the first 6 years of life
19717523 ECP and EDN disrupt skin integrity and cause inflammation
19115260 the roles of the six discrete segments in transcription regulation were investigated and the -350/-329 region (ednR2) was shown to be involved in the regulation of edn expression
19014520 No variation in genes encoding eosinophil-derived neurotoxin for Atopic dermatitis pathogenesis in this German cohort.
More...

AA Sequence

MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTF      1 - 70
LLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDN     71 - 140
RDQRRDPPQYPVVPVHLDRII                                                     141 - 161
//

Text Mined References (62)

PMID Year Title
26534742 Serum eosinophil-derived neurotoxin: correlation with persistent airflow limitation in adults with house-dust mite allergic asthma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25221852 2015 Relationship between SNPs and expression level for candidate genes in rheumatoid arthritis.
24890227 2014 Elevation of fecal eosinophil-derived neurotoxin in infants with food protein-induced enterocolitis syndrome.
24814827 2014 Expression levels of eosinophil granule protein mRNAs in induced sputum reflect airway hyperresponsiveness and airflow limitation.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23533305 2013 Eosinophil-derived neurotoxin is elevated in patients with amyotrophic lateral sclerosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...