Property Summary

NCBI Gene PubMed Count 204
PubMed Score 1382.61
PubTator Score 855.22

Knowledge Summary

Patent

No data available

Gene RIF (201)

AA Sequence

MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSR      1 - 70
QVCADPSEEWVQKYVSDLELSA                                                     71 - 92
//

Text Mined References (204)

PMID Year Title