Property Summary

NCBI Gene PubMed Count 195
Grant Count 417
R01 Count 222
Funding $32,743,269.78
PubMed Score 1347.96
PubTator Score 855.22

Knowledge Summary

Patent

No data available

Synonym

Accession P10147
Symbols MIP1A
SCYA3
G0S19-1
LD78ALPHA
MIP-1-alpha

Gene

PDB

3H44   1B50   1B53   2X69   2X6G   3FPU   3KBX   4RA8   4ZKB   5COR   5D65  

Gene RIF (197)

PMID Text
26854929 Tregs from subjects with established type 1 diabetes were impaired in their ability to produce CCL3 and CCL4.
26713602 CCL3 promotes VEGF-A expression and angiogenesis in human osteosarcoma cells by down-regulating miR-374b expression via JNK, ERK, and p38 signaling pathways.
26620310 Pleural and serum MIP1a were lower in patients with lung cancer compared to lung metastasis, pneumonia, tuberculosis, and transudate pleural effusion.
26494023 An increased MIP-1alpha level in nasopharyngeal aspirates from patients with acute respiratory symptoms during the first wheezing episode caused by viral infections might predict recurrent wheezing.
26472202 The residues on the N-loop and beta-sheets of MIP-1a are close to both CCR1 and CCR5, and those in the C-terminal helix region are close to CCR5.
26155942 CCL2, 3, 14 have roles in stimulating macrophage bone marrow homing, proliferation, and polarization in multiple myeloma
26134542 AEG-1 mediates CCL3/CCR5-induced EMT development via both Erk1/2 and Akt signaling pathway in CM patients, which indicates CCL3/CCR5-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of CM.
25940505 A significantly higher percentage of healthy asymptomatic persons possibly exposed to asbestos had detectable levels of serum CCL3 compared to healthy unexposed control subjects.
25618120 Serum/urinary MIP-1a responds to infection but cannot be used as reliable biomarker in childhood urinary tract infections.
25529283 The expression of HIV-1 Nef in primary human monocyte-derived macrophages (MDM) increases the concentration of MIP-1alpha
More...

AA Sequence

MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSR      1 - 70
QVCADPSEEWVQKYVSDLELSA                                                     71 - 92
//

Text Mined References (195)

PMID Year Title
26854929 2016 T regulatory cell chemokine production mediates pathogenic T cell attraction and suppression.
26713602 2016 CCL3 promotes angiogenesis by dysregulation of miR-374b/ VEGF-A axis in human osteosarcoma cells.
26620310 2015 Expression of YKL-40 and MIP-1a proteins in exudates and transudates: biomarkers for differential diagnosis of pleural effusions? A pilot study.
26494023 2016 MIP-1? level in nasopharyngeal aspirates at the first wheezing episode predicts recurrent wheezing.
26472202 2015 Elucidation of the CCR1- and CCR5-binding modes of MIP-1? by application of an NMR spectra reconstruction method to the transferred cross-saturation experiments.
26155942 2015 Chemokines CCL2, 3, 14 stimulate macrophage bone marrow homing, proliferation, and polarization in multiple myeloma.
26134542 2015 Astrocyte elevated gene-1 regulates CCL3/CCR5-induced epithelial-to-mesenchymal transition via Erk1/2 and Akt signaling in cardiac myxoma.
25940505 2015 Chemokine (C-C motif) ligand 3 detection in the serum of persons exposed to asbestos: A patient-based study.
25618120 Serum and urinary MIP-1? and IP-10 levels in children with urinary tract infections.
25245399 2014 MIP-1? enhances Jurkat cell transendothelial migration by up-regulating endothelial adhesion molecules VCAM-1 and ICAM-1.
More...