Property Summary

NCBI Gene PubMed Count 250
PubMed Score 1890.43
PubTator Score 973.63

Knowledge Summary


No data available


  Disease Sources (4)


  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.271 0.003
psoriasis 3.800 0.000
cutaneous lupus erythematosus 5.000 0.000
osteosarcoma -4.087 0.000
Atopic dermatitis 1.300 0.004
lung cancer -2.600 0.004
sarcoidosis 1.300 0.046
interstitial cystitis 3.100 0.000
primary Sjogren syndrome 1.300 0.003
nasopharyngeal carcinoma 2.000 0.000
lung adenocarcinoma -2.217 0.000
lung carcinoma -1.100 0.000
ulcerative colitis 1.900 0.003
Breast cancer 1.100 0.005
head and neck cancer 2.200 0.014
head and neck cancer and chronic obstruc... 1.400 0.048


Accession P10144 Q8N1D2 Q9UCC1
Symbols C11


PANTHER Protein Class (3)


1FQ3   1IAU  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Horse OMA EggNOG
Horse OMA Inparanoid
Pig OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (201)

27117663 FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review)
26927382 Data show that NK cell lines could secreted rapidly inactive Mr 35 000 granzyme B (GZB)outside secretory lysosomes (SLs).
26830472 Findings show that GrB was produced in 57.1% colorectal cancer cell (CRC) lines and 100% CRC-derived Cancer Stem Cells and present a novel role for GrB as up-modulator of epitelial-to-mesenchimal transition in CRC cells.
26752517 Delivered into parasite infected cells by granulysin and perforin, granzymes generate superoxide and inactivate oxidative defense enzymes to kill the parasite.
26670609 Data suggest that reactive oxygen species (ROS) generated within cytotoxic lymphocytes by receptor stimulation are required for lysosomal permeabilization and release of GzmB (granzyme B) into the cytosol and for inactivation of serpin B9.
26633185 Costimulation blockade by abatacept can decrease the serum levels of GZMB in rheumatoid arthritis patients responding to the treatment.
26610869 these results suggest a perforin-independent, extracellular role for GzmB in the pathogenesis of cardiac fibrosis
26410968 GzmB plays no role in the pathogenesis of keloids and hypertrophic scars.
26314831 Among SLAMF4+ cells, the T cell fraction positive for perforin and granzyme B was higher in those obtained from healthy donors, while the percentage of T cells that were single-positive for granzyme B was higher in cells obtained from patients with SLE.
26207425 identified among the key genes in circulating monocytes that were altered by exercise

AA Sequence

KVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY                                     211 - 247

Text Mined References (252)

PMID Year Title
27117663 2016 Apoptosis Markers in Breast Cancer Therapy.
26927382 2016 [Rapid biosynthesis and release of 35 kD granzyme B by NK92 cells bypassing secretory lysosomes].
26830472 2016 Epitelial-to-mesenchimal transition and invasion are upmodulated by tumor-expressed granzyme B and inhibited by docosahexaenoic acid in human colorectal cancer cells.
26752517 2016 Killer lymphocytes use granulysin, perforin and granzymes to kill intracellular parasites.
26633185 Serum levels of granzyme B decrease in patients with rheumatoid arthritis responding to abatacept.
26610869 2016 Granzyme B Deficiency Protects against Angiotensin II-Induced Cardiac Fibrosis.
26410968 2015 Evaluation of the Role of Granzyme B in Exuberant Scar Pathogenesis: An Immunohistochemical Study.
26314831 2016 Selective Loss of Signaling Lymphocytic Activation Molecule Family Member 4-Positive CD8+ T Cells Contributes to the Decreased Cytotoxic Cell Activity in Systemic Lupus Erythematosus.
26207425 2015 Brief Exercises Affect Gene Expression in Circulating Monocytes.