Property Summary

Ligand Count 16
NCBI Gene PubMed Count 260
PubMed Score 2026.71
PubTator Score 973.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Atopic dermatitis 1.300 3.7e-03
Breast cancer 1.100 5.1e-03
cutaneous lupus erythematosus 5.000 3.3e-06
head and neck cancer 2.200 1.4e-02
head and neck cancer and chronic obstruc... 1.400 4.8e-02
interstitial cystitis 3.100 4.7e-04
lung adenocarcinoma -2.217 1.1e-08
lung cancer -2.600 4.1e-03
lung carcinoma -1.100 7.9e-10
nasopharyngeal carcinoma 2.000 3.0e-06
nephrosclerosis 1.271 3.1e-03
osteosarcoma -4.087 1.1e-04
primary Sjogren syndrome 1.300 3.3e-03
psoriasis 1.300 2.9e-05
sarcoidosis 1.300 4.6e-02
ulcerative colitis 1.900 3.2e-03

 GWAS Trait (1)

Gene RIF (211)

AA Sequence

MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSI      1 - 70
NVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQ     71 - 140
TCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCN    141 - 210
KVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY                                     211 - 247
//

Text Mined References (262)

PMID Year Title