Property Summary

NCBI Gene PubMed Count 48
Grant Count 135
R01 Count 77
Funding $36,907,564.48
PubMed Score 526.65
PubTator Score 281.10

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P10124 B2R4L7 Q5VW06
Symbols PPG
PRG
PRG1

Gene

Gene RIF (19)

PMID Text
26694746 These results suggest functions for serglycin in endothelial cells trough interactions with partner molecules, in biological processes with relevance for diabetic complications, cardiovascular disease and cancer development.
26581653 The elevated levels of serglycin in aggressive cancer and stromal cells may suggest a key role for serglycin in disease progression
24513305 These results suggest that different signaling pathways are involved in regulating secretion of serglycin and partner molecules in activated endothelial cells.
24403068 These studies provide direct evidence for a critical role for serglycin in MM pathogenesis and show that targeting serglycin may provide a novel therapeutic approach for MM.
23996242 The reduced expression of SRGN was accompanied by elevated levels of E-cadherin.
23387827 Cell-surface SRGN promotes the adhesion of myeloma cells to collagen type I.
23376071 These results suggest that human epicardial adipose tissue (EAT) has strong inflammatory properties in patients with coronary artery disease and provide novel evidence that serglycin is an adipocytokine highly expressed in EAT.
22807344 This review covers recent studies on the involvement of serglycin in various pathological conditions, as well as its roles in immunity, hemostasis, cell growth, apoptosis, and reproduction.
21849484 Human granulocyte precursors transfected with siRNA against serglycin displayed reduced capability to retain fully processed HNP-1.
21289131 Serglycin regulates NPC metastasis via autocrine and paracrine routes, and that it serves as an independent prognostic indicator of metastasis-free survival and disease-free survival in NPC patients.
More...

AA Sequence

MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRL      1 - 70
RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNL     71 - 140
PSDSQDLGQHGLEEDFML                                                        141 - 158
//

Text Mined References (51)

PMID Year Title
26694746 2015 Serglycin in Quiescent and Proliferating Primary Endothelial Cells.
26581653 2015 Increased Expression of Serglycin in Specific Carcinomas and Aggressive Cancer Cell Lines.
25416956 2014 A proteome-scale map of the human interactome network.
24513305 2014 Serglycin secretion is part of the inflammatory response in activated primary human endothelial cells in vitro.
24403068 2014 Serglycin proteoglycan is required for multiple myeloma cell adhesion, in vivo growth, and vascularization.
23996242 2013 Serglycin (SRGN) overexpression predicts poor prognosis in hepatocellular carcinoma patients.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23387827 2013 Cell-surface serglycin promotes adhesion of myeloma cells to collagen type I and affects the expression of matrix metalloproteinases.
23376071 2013 Serglycin is a novel adipocytokine highly expressed in epicardial adipose tissue.
22807344 2012 Serglycin in health and diseases.
More...