Property Summary

NCBI Gene PubMed Count 52
PubMed Score 562.96
PubTator Score 281.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0

Expression

  Differential Expression (36)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 9.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.464 1.8e-02
breast carcinoma 1.200 4.3e-02
cutaneous lupus erythematosus 2.800 2.6e-03
cystic fibrosis 3.300 2.0e-05
dermatomyositis 2.200 8.7e-04
Down syndrome 2.100 1.1e-03
Duchenne muscular dystrophy 1.308 1.3e-05
esophageal adenocarcinoma 1.200 3.3e-02
glioblastoma 2.700 1.4e-03
group 4 medulloblastoma -1.900 7.1e-04
Hydrolethalus syndrome 3.666 3.9e-03
interstitial cystitis 2.200 7.8e-04
intraductal papillary-mucinous adenoma (... -2.500 6.8e-03
intraductal papillary-mucinous carcinoma... -3.700 4.3e-04
intraductal papillary-mucinous neoplasm ... -2.900 1.8e-02
invasive ductal carcinoma 1.002 2.2e-02
juvenile dermatomyositis 1.590 1.4e-08
limb girdle muscular dystrophy 2I 1.007 1.4e-02
lung adenocarcinoma -1.900 3.8e-07
lung cancer -2.500 9.9e-03
lung carcinoma -2.600 2.7e-29
malignant mesothelioma -8.300 2.5e-09
medulloblastoma, large-cell -2.300 2.3e-05
Multiple myeloma 1.515 5.8e-03
nephrosclerosis 1.313 1.7e-04
non-small cell lung cancer -1.301 3.7e-12
ovarian cancer -3.100 4.1e-08
pancreatic cancer 1.800 4.6e-04
pancreatic ductal adenocarcinoma liver m... -2.438 1.4e-03
periodontitis 1.400 4.8e-22
pituitary cancer -1.800 1.9e-04
primary Sjogren syndrome 2.300 8.6e-05
psoriasis 1.200 4.4e-03
ulcerative colitis 4.200 8.1e-08
Waldenstrons macroglobulinemia 2.416 6.4e-03

 GO Function (1)

Gene RIF (23)

AA Sequence

MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRL      1 - 70
RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNL     71 - 140
PSDSQDLGQHGLEEDFML                                                        141 - 158
//

Text Mined References (55)

PMID Year Title