Property Summary

NCBI Gene PubMed Count 45
Grant Count 39
R01 Count 16
Funding $5,390,233.66
PubMed Score 111.80
PubTator Score 57.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma 1.100 0.036
astrocytic glioma 1.300 0.015
psoriasis 1.700 0.000
osteosarcoma 3.175 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.100 0.000
Common variable immunodeficiency 1.310 0.022
active Crohn's disease 1.149 0.016
group 3 medulloblastoma -1.300 0.010
posterior fossa group B ependymoma -1.100 0.001
primary Sjogren syndrome 1.200 0.004
lung carcinoma 1.700 0.000
gastric carcinoma 1.200 0.012
ovarian cancer 1.800 0.000

Gene RIF (19)

PMID Text
26488411 Single nucleotide polymorphism in RAP2A gene is associated with Peripheral Arterial Disease.
25980814 present review mainly focused on recent studies on the functional and physical interactions between Rap2 and its effectors. We also speculated on the relevance of these pathways to tumorigenesis
25728512 The ectopic expression of Rap2a enhances the migration and invasive ability of cancer cells and increases activities of matrix metalloproteinase MMP2 and MMP9.
25533468 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25248704 the role of Rap2a in carcinogenesis
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
24293123 downregulation of Rap2a promoted glioma migration and invasion, and raised the phosphorylation level of AKT
23469100 endothelial barrier resistance is determined by the combined antagonistic actions of Rap1 and Rap2
22797597 Rap2A and TNIK control brush border formation by apical recruitment of MST4 and the subsequent phosphorylation of Ezrin
19645719 analyzed residues that allow RasGEF1 proteins to discriminate between Rap1 and Rap2, and identified Phe39 in the switch I region of Rap2 as a specificity residue.
More...

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL      1 - 70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC     71 - 140
PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ                               141 - 183
//

Text Mined References (51)

PMID Year Title
26488411 2015 Genome-Wide Association Study of Peripheral Arterial Disease in a Japanese Population.
25980814 2015 Role of Rap2 and its Downstream Effectors in Tumorigenesis.
25728512 2015 Rap2a is a novel target gene of p53 and regulates cancer cell migration and invasion.
25533468 2015 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25248704 2014 [Identification analysis of eukaryotic expression plasmid Rap2a and its effect on the migration of lung cancer cells].
24293123 2014 Over-expression of Rap2a inhibits glioma migration and invasion by down-regulating p-AKT.
23894443 2013 Coiled-coil domain containing protein 124 is a novel centrosome and midbody protein that interacts with the Ras-guanine nucleotide exchange factor 1B and is involved in cytokinesis.
23469100 2013 Rap1 and Rap2 antagonistically control endothelial barrier resistance.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
More...