Property Summary

NCBI Gene PubMed Count 47
PubMed Score 120.82
PubTator Score 57.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.149 1.6e-02
astrocytic glioma 1.300 1.5e-02
atypical teratoid / rhabdoid tumor -1.100 2.7e-08
Common variable immunodeficiency 1.310 2.2e-02
gastric carcinoma 1.200 1.2e-02
group 3 medulloblastoma -1.300 9.6e-03
lung carcinoma 1.700 3.4e-19
medulloblastoma, large-cell -1.100 4.3e-05
osteosarcoma 3.175 7.9e-09
ovarian cancer -1.100 8.8e-06
posterior fossa group B ependymoma -1.100 9.5e-04
primary Sjogren syndrome 1.200 4.3e-03
psoriasis 1.500 2.6e-08
urothelial carcinoma 1.100 3.6e-02

Gene RIF (21)

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL      1 - 70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC     71 - 140
PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ                               141 - 183
//

Text Mined References (53)

PMID Year Title