Property Summary

NCBI Gene PubMed Count 32
Grant Count 46
R01 Count 44
Funding $3,626,213.05
PubMed Score 650.77
PubTator Score 31.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.269 0.008
adrenocortical carcinoma -1.345 0.016
pancreatic ductal adenocarcinoma liver m... -1.698 0.042
ulcerative colitis -1.200 0.000
ovarian cancer 1.200 0.003

Gene RIF (13)

PMID Text
26431901 TNFSF13 and FDX1 have potential roles in IgAN in the Han Chinese population. This information may be useful in the development of early prognostics for IgAN.
26370181 Did not find any positive association between FDX1 SNPs and the risk of IgA nephropathy after adjustment for age and sex, but did find a significant and strong correlation with relevant clinical pathological parameters.
23435367 results indicate transcription of FDX1 is regulated by the NR5A family and cAMP signaling, and participates in steroid hormone production in ovarian granulosa ce
22101253 Data suggest that interference with any of the three related genes, ferredoxin (FDX)1, FDX2 or FDXR, disrupts iron-sulfur cluster assembly and maintenance of normal cytosolic and mitochondrial iron homeostasis.
21636783 Results present the crystal structure of the complex of human adrenodoxin and CYP11A1--the first of a complex between a eukaryotic CYP and its redox partner.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20689807 Observational study of gene-disease association. (HuGE Navigator)
20547883 Unlike Fdx1, Fdx2 was unable to efficiently reduce mitochondrial cytochromes P450 and convert steroids, indicating that the two ferredoxin isoforms are highly specific for their substrates in distinct biochemical pathways.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH      1 - 70
FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL     71 - 140
AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS                              141 - 184
//

Text Mined References (37)

PMID Year Title
26431901 2015 Genetic polymorphisms in TNFSF13 and FDX1 are associated with IgA nephropathy in the Han Chinese population.
26370181 2015 Association between CCDC132, FDX1 and TNFSF13 gene polymorphisms and the risk of IgA nephropathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23435367 2013 Transcriptional regulation of human ferredoxin 1 in ovarian granulosa cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22101253 2012 Both human ferredoxins 1 and 2 and ferredoxin reductase are important for iron-sulfur cluster biogenesis.
21636783 2011 Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
21269460 2011 Initial characterization of the human central proteome.
More...