Property Summary

NCBI Gene PubMed Count 20
Grant Count 3
Funding $407,059
PubMed Score 27.33
PubTator Score 55.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 2.434 0.000
sonic hedgehog group medulloblastoma 2.900 0.002
psoriasis -1.200 0.000

Synonym

Accession P10092 A8K573 D3DQX4 Q569I0 Q9UCN9
Symbols CALC2
CGRP2
CGRP-II

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
21641113 Keratinocyte-derived CGRPbeta may modulate epidermal homeostasis through autocrine/paracrine signaling and may contribute to chronic pain under pathological conditions.
19192276 Calcitonin gene-related peptide stimulates proliferation of alveolar epithelial cells.
19086053 Observational study of gene-disease association. (HuGE Navigator)
15761041 CGRP and ADM are two differentially regulated novel adipose tissue secretion factors exerting autocrine/paracrine roles.

AA Sequence

MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQE      1 - 70
TQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA                  71 - 127
//

Text Mined References (20)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21641113 2011 Keratinocyte expression of calcitonin gene-related peptide ?: implications for neuropathic and inflammatory pain mechanisms.
19192276 2009 Calcitonin gene-related peptide stimulates proliferation of alveolar epithelial cells.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
15761041 2005 Autocrine/paracrine role of inflammation-mediated calcitonin gene-related peptide and adrenomedullin expression in human adipose tissue.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...