Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.92
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRD      1 - 70
TFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPR     71 - 140
GAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKP    141 - 210
YACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSS    211 - 280
NLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKP    281 - 350
FACGACGKAFGQSSQLIQHQRVHYRE                                                351 - 376
//

Text Mined References (11)

PMID Year Title