Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Disease Target Count P-value
glioblastoma 5792 5.4e-07
medulloblastoma 720 1.6e-04
osteosarcoma 7950 3.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.300 5.4e-07
medulloblastoma 1.100 1.6e-04
osteosarcoma -1.186 3.5e-04

AA Sequence

MAIPKHSLSPVPWEEDSFLQVKVEEEEEASLSQGGESSHDHIAHSEAARLRFRHFRYEEASGPHEALAHL      1 - 70
RALCCQWLQPEAHSKEQILELLVLEQFLGALPPEIQAWVGAQSPKSGEEAAVLVEDLTQVLDKRGWDPGA     71 - 140
EPTEASCKQSDLGESEPSNVTETLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKSVTQQIHFKKTSGP    141 - 210
YKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSA    211 - 280
SALEAHQKTHSRKTPYACSECGKAFSRSTHLAQHQVVHTGAKPHECKECGKAFSRVTHLTQHQRIHTGEK    281 - 350
PYKCGECGKTFSRSTHLTQHQRVHTGERPYECDACGKAFSQSTHLTQHQRIHTGEKPYKCDACGRAFSDC    351 - 420
SALIRHLRIHSGEKPYQCKVCPKAFAQSSSLIEHQRIHTGEKPYKCSDCGKAFSRSSALMVHLRIHITVL    421 - 490
Q//

Text Mined References (15)

PMID Year Title