Property Summary

NCBI Gene PubMed Count 120
PubMed Score 1388.06
PubTator Score 227.33

Knowledge Summary


No data available


  Disease Sources (7)

Disease Target Count P-value
lung carcinoma 2844 2.42278202970115E-21
ovarian cancer 8492 1.09203272164399E-10
posterior fossa group B ependymoma 1530 5.10399571007112E-9
group 4 medulloblastoma 1875 8.52717367157315E-7
osteosarcoma 7933 3.44462244691601E-5
Breast cancer 3099 6.52834595465943E-5
glioblastoma 5572 0.0014745225080722
psoriasis 6685 0.00175283615685929
pediatric high grade glioma 2712 0.0021420233439598
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00455092170607772
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00518187117019071
non primary Sjogren syndrome sicca 840 0.0178963094983566
atypical teratoid / rhabdoid tumor 4369 0.0249912076358905
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Allergic rhinitis 92 0.0 1.0



Accession P10071 A4D1W1 O75219 Q17RW4 Q75MT0 Q75MU9 Q9UDT5 Q9UJ39
Symbols PHS




  Ortholog (10)

Gene RIF (72)

26515020 To date, at least ten loci and four non-syndromic polydactyly-causing genes, including the GLI3 gene, the ZNF141 gene, the MIPOL1 gene and the PITX1 gene, have been identified. (Review)
26290227 from ESCs and induced pluripotent stem cells. SIGNIFICANCE STATEMENT: Our study presents a rapid and efficient protocol to generate human motoneurons from embryonic and induced pluripotent stem cells.
26261006 Identify mutations that increase GLI activity in patients with Hirschsprung disease.
25714367 We report on a patient with GCPS caused by a novel GLI3 mutation.
25278022 Fu ubiquitination and cleavage is one of the key elements connecting the MID1-PP2A protein complex with GLI3 activity control
25267529 Data identifies a His601Arg mutation in the ZFD domain of GLI3 leading to phenotypic variability including an isolated limb phenotype in a jewish family.
25103784 High expression of GLI1 mRNA was associated with advanced lung adenocarcinoma.
24819706 GLI3 mutation is associated with esophageal atresia.
24667698 the role of GLI3 in a significant fraction of patients with non-syndromic bilateral polydactyly affecting both hands and feet
24608427 This newly identified miR-506/Gli3 axis provides further insight into the pathogenesis of cervical cancer and indicates a potential novel therapeutic agent for the treatment of cervical cancer.

AA Sequence

PRASLPFPALSMSTTNMAIGDMSSLLTSLAEESKFLAVMQ                                 1541 - 1580

Text Mined References (125)

PMID Year Title
26515020 2015 Advances in the molecular genetics of non-syndromic polydactyly.
26290227 2015 Retinoic Acid-Mediated Regulation of GLI3 Enables Efficient Motoneuron Derivation from Human ESCs in the Absence of Extrinsic SHH Activation.
26261006 2015 Identification of GLI Mutations in Patients With Hirschsprung Disease That Disrupt Enteric Nervous System Development in Mice.
25714367 2015 Novel GLI3 mutation in a Greek-Cypriot patient with Greig cephalopolysyndactyly syndrome.
25278022 2014 The E3 ubiquitin ligase MID1 catalyzes ubiquitination and cleavage of Fu.
25267529 2014 A novel GLI3 mutation affecting the zinc finger domain leads to preaxial-postaxial polydactyly-syndactyly complex.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25103784 2014 Expression of the GLI family genes is associated with tumor progression in advanced lung adenocarcinoma.
24819706 2014 De novo GLI3 mutation in esophageal atresia: reproducing the phenotypic spectrum of Gli3 defects in murine models.
24667698 2014 Novel frame-shift mutations of GLI3 gene in non-syndromic postaxial polydactyly patients.