Property Summary

NCBI Gene PubMed Count 112
Grant Count 256
R01 Count 155
Funding $21,166,355.53
PubMed Score 325.15
PubTator Score 2335.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession P10070 O60252 O60253 O60254 O60255 Q15590 Q15591 Q4JHT4
Symbols CJS
HPE9
PHS2
THP1
THP2

Gene

Gene RIF (92)

PMID Text
26896768 ALDH1A1 stabilizes the Gli2 protein in an enzyme-independent manner in hepatocellular cancer.
26769961 GLI2 stabilized glial cell missing-a, a pivotal transcriptional factor for trophoblastic syncytialization.
26588701 GLI1 and GLI2, but not GLI3 are involved in the regulation of SOX18 gene expression in cervical carcinoma cell lines.
26290144 The results do not support our hypothesis that common germline genetic variants in the GLI2 genes is associated with the risk of developing medulloblastoma.
26261006 Identify mutations that increase GLI activity in patients with Hirschsprung disease.
26238143 Rab23 is expressed in breast cancer cells, and ectopic expression of Rab23 inhibits the growth and proliferation as well as induces cell apoptosis in breast cancer cells These effects may be due to the inhibition by Rab23 of Gli1 and Gli2 mRNA expression
26182949 Serum starvation significantly up-regulated the expression of Gli1, which in turn increased its key target cIAP2 expression and enhanced NF-kappaB/cIAP2 pathway, resulting in promoting cell survival under serum starvation
25974718 GLI2 mutations typically result in pituitary anomalies with or without postaxial polydactyly.
25964059 hsa-miR-665 and hsa-miR-95 were downregulated in GSRCC but upregulated in intestinal gastric adenocarcinoma, and the relatively differential expression of the miRNAs negatively controlling their target genes, GLI2 and PLCG1
25889765 GLI2 forms part of a core HH pathway transcriptional regulatory network that promotes human myeloid leukemic progression and dormant LSC generation
More...

AA Sequence

METSASATASEKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHAPLPIDMRHQE      1 - 70
GRYHYEPHSVHGVHGPPALSGSPVISDISLIRLSPHPAGPGESPFNAPHPYVNPHMEHYLRSVHSSPTLS     71 - 140
MISAARGLSPADVAQEHLKERGLFGLPAPGTTPSDYYHQMTLVAGHPAPYGDLLMQSGGAASAPHLHDYL    141 - 210
NPVDVSRFSSPRVTPRLSRKRALSISPLSDASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGA    211 - 280
LSPAFTFPHPINPVAYQQILSQQRGLGSAFGHTPPLIQPSPTFLAQQPMALTSINATPTQLSSSSNCLSD    281 - 350
TNQNKQSSESAVSSTVNPVAIHKRSKVKTEPEGLRPASPLALTQGQVSGHGSCGCALPLSQEQLADLKED    351 - 420
LDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYML    421 - 490
VVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSN    491 - 560
EKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEA    561 - 630
SSTSQAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDT    631 - 700
PPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILEN    701 - 770
FSGSGGGGPAGLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASP    771 - 840
LGAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGLLNLTPAQQYSLRAKYAAATGGPPPTPLPGLER    841 - 910
MSLRTRLALLDAPERTLPAGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHEAPGGGARRASDPVRRPDALS    911 - 980
LPRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLARGAYSPRPPSISENVAMEAVAAGVDGAGPE    981 - 1050
ADLGLPEDDLVLPDDVVQYIKAHASGALDEGTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPS   1051 - 1120
APMLGGCQLGFGAPSSLNKNNMPVQWNEVSSGTVDALASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQG   1121 - 1190
LQASPGGLDSTQPHLQPRSGAPSQGIPRVNYMQQLRQPVAGSQCPGMTTTMSPHACYGQVHPQLSPSTIS   1191 - 1260
GALNQFPQSCSNMPAKPGHLGHPQQTEVAPDPTTMGNRHRELGVPDSALAGVPPPHPVQSYPQQSHHLAA   1261 - 1330
SMSQEGYHQVPSLLPARQPGFMEPQTGPMGVATAGFGLVQPRPPLEPSPTGRHRGVRAVQQQLAYARATG   1331 - 1400
HAMAAMPSSQETAEAVPKGAMGNMGSVPPQPPPQDAGGAPDHSMLYYYGQIHMYEQDGGLENLGSCQVMR   1401 - 1470
SQPPQPQACQDSIQPQPLPSPGVNQVSSTVDSQLLEAPQIDFDAIMDDGDHSSLFSGALSPSLLHSLSQN   1471 - 1540
SSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT                           1541 - 1586
//

Text Mined References (118)

PMID Year Title
26896768 2016 Aldehyde dehydrogenase 1A1 stabilizes transcription factor Gli2 and enhances the activity of Hedgehog signaling in hepatocellular cancer.
26769961 2016 Glioma-associated Oncogene 2 Is Essential for Trophoblastic Fusion by Forming a Transcriptional Complex with Glial Cell Missing-a.
26588701 2015 SOX18 Is a Novel Target Gene of Hedgehog Signaling in Cervical Carcinoma Cell Lines.
26290144 2015 CCND2, CTNNB1, DDX3X, GLI2, SMARCA4, MYC, MYCN, PTCH1, TP53, and MLL2 gene variants and risk of childhood medulloblastoma.
26261006 2015 Identification of GLI Mutations in Patients With Hirschsprung Disease That Disrupt Enteric Nervous System Development in Mice.
26238143 2015 Effect of Rab23 on the proliferation and apoptosis in breast cancer.
26182949 2015 Up-Regulation of Glioma-Associated Oncogene Homolog 1 Expression by Serum Starvation Promotes Cell Survival in ER-Positive Breast Cancer Cells.
25974718 2015 GLI2 mutations typically result in pituitary anomalies with or without postaxial polydactyly.
25964059 2015 Screening of differential microRNA expression in gastric signet ring cell carcinoma and gastric adenocarcinoma and target gene prediction.
25889765 2015 GLI2 inhibition abrogates human leukemia stem cell dormancy.
More...