Property Summary

Ligand Count 1
NCBI Gene PubMed Count 137
PubMed Score 5859.51
PubTator Score 609.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.800 1.5e-04
astrocytic glioma -1.400 7.3e-03
Astrocytoma, Pilocytic -1.400 2.8e-07
atypical teratoid / rhabdoid tumor -1.100 1.4e-06
Breast cancer 1.100 6.7e-10
ependymoma -1.200 1.0e-02
Gaucher disease type 1 1.500 2.2e-02
glioblastoma -1.100 4.8e-05
group 3 medulloblastoma -1.200 3.0e-02
medulloblastoma, large-cell -2.200 9.3e-05
oligodendroglioma -1.200 2.6e-02
osteosarcoma -1.213 2.6e-03
ovarian cancer -1.100 2.4e-04
Pick disease -1.100 6.5e-05
primitive neuroectodermal tumor -1.100 1.4e-03
psoriasis -4.700 2.1e-06
subependymal giant cell astrocytoma -2.106 8.6e-03

Gene RIF (34)

AA Sequence

MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL      1 - 70
TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE     71 - 140
EFVQMMTAK                                                                 141 - 149
//

Text Mined References (154)

PMID Year Title