Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0DO97
Symbols LINC01183

Gene

 Compartment GO Term (0)

AA Sequence

MMPVDVCPRDRGSQWVWLEMGQCYSKKSVVPESDTSERSSMTSGSSESDIPQENKVSKASLDTGQMAFTL      1 - 70
AQLESLEICLKEAEEKAKALSEQLSVSEGTKSKLLEQVSRLEEKLEAVDHKEASGGPYEKMVLVKDQCIQ     71 - 140
KLQAEVKASQEQLIAQKLKHEKKVKKLQTDLATANAITVLELNEKIKTLYEGKPAPREDSLLEGFCGGLP    141 - 210
PVEEGDRKISLIMELSTQVSLQTERITQLKEVLEEKERKIQQLEAERSPHPPQEVKDPPGCLPEAPVFST    211 - 280
HDIPPVVSDENL                                                              281 - 292
//

Text Mined References (4)

PMID Year Title
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
19023125 2009 A genome-wide association study of schizophrenia using brain activation as a quantitative phenotype.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
11181995 2001 The sequence of the human genome.