Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0DO97
Symbols LINC01183

Gene

 Compartment GO Term (0)

AA Sequence

MMPVDVCPRDRGSQWVWLEMGQCYSKKSVVPESDTSERSSMTSGSSESDIPQENKVSKASLDTGQMAFTL      1 - 70
AQLESLEICLKEAEEKAKALSEQLSVSEGTKSKLLEQVSRLEEKLEAVDHKEASGGPYEKMVLVKDQCIQ     71 - 140
KLQAEVKASQEQLIAQKLKHEKKVKKLQTDLATANAITVLELNEKIKTLYEGKPAPREDSLLEGFCGGLP    141 - 210
PVEEGDRKISLIMELSTQVSLQTERITQLKEVLEEKERKIQQLEAERSPHPPQEVKDPPGCLPEAPVFST    211 - 280
HDIPPVVSDENL                                                              281 - 292
//

Text Mined References (4)

PMID Year Title