Property Summary

NCBI Gene PubMed Count 24
PubMed Score 80.49
PubTator Score 3.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
22032922 Expression of the CGB7 gene is upregulated upon p53 induction in human HFF, HCT116 and DLD1 cells as well as in cell preparations enriched in human primary first-trimester trophoblasts.

AA Sequence

MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLP      1 - 70
ALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSS     71 - 140
SKAPPPSLPSPSRLPGPSDTPILPQ                                                 141 - 165
//

Text Mined References (26)

PMID Year Title
22032922 2011 The tumor suppressor p53 induces expression of the pregnancy-supporting human chorionic gonadotropin (hCG) CGB7 gene.
16123088 2005 Expression of beta-subunit of HCG genes during normal and failed pregnancy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11861891 2002 Chorionic gonadotropin has a recent origin within primates and an evolutionary history of selection.
10468638 1999 Abortive expansion of the cumulus and impaired fertility in mice lacking the prostaglandin E receptor subtype EP(2).
9012484 1997 Malignant transformation of nontrophoblastic cells is associated with the expression of chorionic gonadotropin beta genes normally transcribed in trophoblastic cells.
8202136 1994 Crystal structure of human chorionic gonadotropin.
7462224 1981 The amino acid sequences of the prepeptides contained in the alpha and beta subunits of human choriogonadotropin.
More...