Property Summary

NCBI Gene PubMed Count 24
PubMed Score 82.54
PubTator Score 3.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLP      1 - 70
ALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSS     71 - 140
SKAPPPSLPSPSRLPGPSDTPILPQ                                                 141 - 165
//

Text Mined References (26)

PMID Year Title