Property Summary

NCBI Gene PubMed Count 12
PubMed Score 114.69
PubTator Score 5.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 3.4e-02

AA Sequence

MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLP      1 - 70
ALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS     71 - 140
SKAPPPSLPSPSRLPGPSDTPILPQ                                                 141 - 165
//

Text Mined References (25)

PMID Year Title