Property Summary

NCBI Gene PubMed Count 12
Grant Count 29
R01 Count 5
Funding $15,457,114.31
PubMed Score 110.94
PubTator Score 5.12

Knowledge Summary

Patent

No data available

AA Sequence

MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLP      1 - 70
ALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS     71 - 140
SKAPPPSLPSPSRLPGPSDTPILPQ                                                 141 - 165
//

Text Mined References (25)

PMID Year Title
16123088 2005 Expression of beta-subunit of HCG genes during normal and failed pregnancy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11861891 2002 Chorionic gonadotropin has a recent origin within primates and an evolutionary history of selection.
9012484 1997 Malignant transformation of nontrophoblastic cells is associated with the expression of chorionic gonadotropin beta genes normally transcribed in trophoblastic cells.
8202136 1994 Crystal structure of human chorionic gonadotropin.
7462224 1981 The amino acid sequences of the prepeptides contained in the alpha and beta subunits of human choriogonadotropin.
7240231 1981 Assignment of disulfide bonds in the beta subunit of human chorionic gonadotropin.
More...