Knowledge Summary

Patent

No data available

AA Sequence

MAEKGSTFSHLLVPILLLIGWIVGCIIMIYVVFS                                          1 - 34
//

Text Mined References (2)

PMID Year Title