Knowledge Summary

Patent

No data available

AA Sequence

MAEKGSTFSHLLVPILLLIGWIVGCIIMIYVVFS                                          1 - 34
//

Text Mined References (2)

PMID Year Title
26816378 2016 A peptide encoded by a transcript annotated as long noncoding RNA enhances SERCA activity in muscle.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.