Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVAGNGAILMIVISDPRLHSPMYFFLGNLSCLDIC      1 - 70
YSSVTLPKMLQNFLSAHKAISFLGCISQLHFFHFLGSTEAMLLAVMAFDRFVAICKPLRYTVIMNPQLCT     71 - 140
QMAITIWMIGFFHALLHSLMTSRLNFCGSNRIYHFFCDVKPLLKLSNQWLLSTVTGTIAMGPFFLTLLSY    141 - 210
FYIITHLFFKTHSFSMLRKALSTCASHFMVVILLYAPVLFTYIHHASGTSMDQDRITAIMYTVVTPVLNP    211 - 280
LIYTLRNKEVKGAFNRAMKRWLWPKEILK                                             281 - 309
//

Text Mined References (2)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
14574404 2003 The DNA sequence and analysis of human chromosome 6.