Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.0e-19

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.300 2.0e-19

AA Sequence

MDDENATLLTEFVLTGLTYQSEWKIPLFLAFLVIYLITIMANLGLIAVIWKDSHLHIPMYLFLGSLAFVD      1 - 70
AWLSSSVTPKMLISFLAKSMIISVSECKIQFFSFGISGTTECFLLATMAYDRYVAICKPLLYPVIMTNGL     71 - 140
CIWLLVLSFIGGFLHALIHEGILFRLTFCNSNIIHHFYCDIIPLLKISCTDPSINFLMLFILSGSIQVFT    141 - 210
ILTVLVSYTFVLFTILKKKAKDIRKAFSTCGAHLLSVSLYYGPLLFMYVHPASPQADDQDMVESLFYTVI    211 - 280
IPFLNPIIYSLRNKQVIDSLTKTLKGNV                                              281 - 308
//

Text Mined References (4)

PMID Year Title