Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.300 0.000

AA Sequence

MDDENATLLTEFVLTGLTYQSEWKIPLFLAFLVIYLITIMANLGLIAVIWKDSHLHIPMYLFLGSLAFVD      1 - 70
AWLSSSVTPKMLISFLAKSMIISVSECKIQFFSFGISGTTECFLLATMAYDRYVAICKPLLYPVIMTNGL     71 - 140
CIWLLVLSFIGGFLHALIHEGILFRLTFCNSNIIHHFYCDIIPLLKISCTDPSINFLMLFILSGSIQVFT    141 - 210
ILTVLVSYTFVLFTILKKKAKDIRKAFSTCGAHLLSVSLYYGPLLFMYVHPASPQADDQDMVESLFYTVI    211 - 280
IPFLNPIIYSLRNKQVIDSLTKTLKGNV                                              281 - 308
//

Text Mined References (4)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14983052 2004 The human olfactory receptor gene family.
12908129 2003 Natural selection on the olfactory receptor gene family in humans and chimpanzees.