Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 HCA RNA Cell Line (1)

Gene RIF (1)

PMID Text
19493002 Immunoreactivity to anti-OPN1LW antibodies was seen in the basal layer of human epidermis & reconstructed skin. The opsin mRNA was seen in total RNA from human skin. Neither immunoreactivity nor mRNA expression was seen in cultured human keratinocytes.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVIASVFT      1 - 70
NGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITG     71 - 140
LWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSG    141 - 210
SSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFC    211 - 280
WGPYAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSA    281 - 350
SKTEVSSVSSVSPA                                                            351 - 364
//

Text Mined References (10)

PMID Year Title
22888021 2012 G protein-coupled receptors participate in cytokinesis.
20579627 2010 X-linked cone dystrophy caused by mutation of the red and green cone opsins.
19493002 2009 Expressions of rod and cone photoreceptor-like proteins in human epidermis.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
15772651 2005 The DNA sequence of the human X chromosome.
10319869 1999 Position of a 'green-red' hybrid gene in the visual pigment array determines colour-vision phenotype.
8185948 1994 Molecular determinants of human red/green color discrimination.
3303660 1986 Molecular biology of the visual pigments.
2937147 1986 Molecular genetics of human color vision: the genes encoding blue, green, and red pigments.
1302020 1992 Defective colour vision associated with a missense mutation in the human green visual pigment gene.