Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DN77
Symbols GOP

Gene

Gene RIF (1)

PMID Text
19493002 Immunoreactivity to anti-OPN1LW antibodies was seen in the basal layer of human epidermis & reconstructed skin. The opsin mRNA was seen in total RNA from human skin. Neither immunoreactivity nor mRNA expression was seen in cultured human keratinocytes.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVIASVFT      1 - 70
NGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITG     71 - 140
LWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSG    141 - 210
SSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFC    211 - 280
WGPYAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSA    281 - 350
SKTEVSSVSSVSPA                                                            351 - 364
//

Text Mined References (10)

PMID Year Title
22888021 2012 G protein-coupled receptors participate in cytokinesis.
20579627 2010 X-linked cone dystrophy caused by mutation of the red and green cone opsins.
19493002 2009 Expressions of rod and cone photoreceptor-like proteins in human epidermis.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
15772651 2005 The DNA sequence of the human X chromosome.
10319869 1999 Position of a 'green-red' hybrid gene in the visual pigment array determines colour-vision phenotype.
8185948 1994 Molecular determinants of human red/green color discrimination.
3303660 1986 Molecular biology of the visual pigments.
2937147 1986 Molecular genetics of human color vision: the genes encoding blue, green, and red pigments.
1302020 1992 Defective colour vision associated with a missense mutation in the human green visual pigment gene.