Property Summary

NCBI Gene PubMed Count 89
PubMed Score 73.59
PubTator Score 68.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (41)

AA Sequence

MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVS      1 - 70
DVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPI     71 - 140
HAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKKHRSRSRSRERRSRSRDRG    141 - 210
RGGGGGGGGGGGGRERDRRRSRDRERSGRF                                            211 - 240
//

Text Mined References (96)

PMID Year Title