Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.86

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MVNSVIFFDITVDGKPLGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTHP      1 - 70
NGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGKVKERVNIVE     71 - 140
AMEHFGYRNSKTSKKITIADCGQF                                                  141 - 164
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.