Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
glioblastoma 5792 6.8e-07
Astrocytoma, Pilocytic 3081 1.8e-05
adult high grade glioma 3801 6.1e-04
ovarian cancer 8520 1.0e-02

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.100 6.1e-04
Astrocytoma, Pilocytic 1.200 1.8e-05
glioblastoma 1.400 6.8e-07
ovarian cancer 1.100 1.0e-02

AA Sequence

MVSASGTSFFKGMLLGSISWVLITMFGQIHIRHRGQTQDHEHHHLRPPNRNDFLNTSKVILLELSKSIRV      1 - 70
FCIIFGESEDESYWAVLKETWTKHCDKAELYDTKNDNLFNIESNDRWVQMRTAYKYVFEKYGDNYNWFFL     71 - 140
ALPTTFAVIENLKYLLFTRDASQPFYLGHTVIFGDLEYVTVEGGIVLSRELMKRLNRLLDNSETCADQSV    141 - 210
IWKLSEDKQLAICLKYAGVHAENAEDYEGRDVFNTKPIAQLIEEALSNNPQQVVEGCCSDMAITFNGLTP    211 - 280
QKMEVMMYGLYRLRAFGHYFNDTLVFLPPVGSEND                                       281 - 315
//

Text Mined References (2)

PMID Year Title