Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.600 0.001
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 1.300 0.000
ovarian cancer 1.100 0.010

AA Sequence

MVSASGTSFFKGMLLGSISWVLITMFGQIHIRHRGQTQDHEHHHLRPPNRNDFLNTSKVILLELSKSIRV      1 - 70
FCIIFGESEDESYWAVLKETWTKHCDKAELYDTKNDNLFNIESNDRWVQMRTAYKYVFEKYGDNYNWFFL     71 - 140
ALPTTFAVIENLKYLLFTRDASQPFYLGHTVIFGDLEYVTVEGGIVLSRELMKRLNRLLDNSETCADQSV    141 - 210
IWKLSEDKQLAICLKYAGVHAENAEDYEGRDVFNTKPIAQLIEEALSNNPQQVVEGCCSDMAITFNGLTP    211 - 280
QKMEVMMYGLYRLRAFGHYFNDTLVFLPPVGSEND                                       281 - 315
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11181995 2001 The sequence of the human genome.