Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0DN24
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MSRGQFGQGQEPLDMFFWVNEISGEITYPPQKADAPAVSPESPQKKPPFQPRSVQEAPCSPQGPPAQRPA      1 - 70
LAPPSKPSLKDSGSRNPCPSAPTWARPKPEE                                            71 - 101
//

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.