Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Synonym

Accession P0DMW5
Symbols LINC00087
NCRNA00087

Gene

 Compartment GO Term (0)

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLN      1 - 70
VRLQVRIE                                                                   71 - 78
//

Text Mined References (1)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.