Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.0e-37

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 3.0e-37

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLN      1 - 70
VRLQVRIE                                                                   71 - 78
//

Text Mined References (1)

PMID Year Title