Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.600 0.002
ependymoma -2.900 0.004
oligodendroglioma -2.400 0.008
glioblastoma -3.200 0.000
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -1.900 0.007
adult high grade glioma -2.900 0.000
pilocytic astrocytoma -2.700 0.000
acute myeloid leukemia 1.600 0.029
Breast cancer -2.400 0.000
breast carcinoma -1.100 0.000
Pick disease -1.200 0.010
pituitary cancer 2.100 0.000
psoriasis -1.400 0.000

Synonym

Accession P0DMW4
Symbols LED
LINC00086
NCRNA00086

Gene

 Compartment GO Term (0)

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLN      1 - 70
VRLQVRIE                                                                   71 - 78
//

Text Mined References (5)

PMID Year Title
25813522 2015 Genome-wide profiling of p53-regulated enhancer RNAs uncovers a subset of enhancers controlled by a lncRNA.
15772651 2005 The DNA sequence of the human X chromosome.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.