Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia 1.600 2.9e-02
adult high grade glioma -2.900 4.8e-06
astrocytic glioma -2.600 2.0e-03
Astrocytoma, Pilocytic -2.700 2.0e-08
atypical teratoid / rhabdoid tumor -3.300 3.7e-07
Breast cancer -2.400 4.3e-31
breast carcinoma -1.100 3.5e-25
ependymoma -2.900 4.0e-03
glioblastoma -2.600 1.6e-08
group 3 medulloblastoma -2.400 3.9e-03
medulloblastoma, large-cell -4.500 3.5e-06
oligodendroglioma -2.400 8.3e-03
Pick disease -1.200 9.5e-03
pituitary cancer 2.100 4.4e-06
primitive neuroectodermal tumor -1.900 7.2e-03
psoriasis -1.400 3.8e-85

AA Sequence

MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLN      1 - 70
VRLQVRIE                                                                   71 - 78
//

Text Mined References (1)

PMID Year Title