Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MEALGSGHYVGGSIRSMAAAALSGLAVRLSRPQGTRGSYGAFCKTLTRTLLTFFDLAWRLRKNFFYFYIL      1 - 70
ASVILNVHLQVYI                                                              71 - 83
//

Text Mined References (2)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.