Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 8.8e-04

Expression

AA Sequence

MEALGSGHYVGGSIRSMAAAALSGLAVRLSRPQGTRGSYGAFCKTLTRTLLTFFDLAWRLRKNFFYFYIL      1 - 70
ASVILNVHLQVYI                                                              71 - 83
//

Text Mined References (2)

PMID Year Title