Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.000

AA Sequence

MVSSAQLDFNLQALLGQLSQDDLCKFKSLIRTVSLGNELQKIPQT                               1 - 45
//

Text Mined References (3)

PMID Year Title
24871464 2014 The CLRX.1/NOD24 (NLRP2P) pseudogene codes a functional negative regulator of NF-?B, pyrin-only protein 4.
15772651 2005 The DNA sequence of the human X chromosome.
12766759 2003 NODs: intracellular proteins involved in inflammation and apoptosis.