Property Summary

NCBI Gene PubMed Count 170
PubMed Score 0.00
PubTator Score 112.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis and treatment for 3 months 327 9.88952632552531E-7
lung cancer 4473 4.64894284468083E-6
hepatocellular carcinoma 550 7.42765409149228E-6
pituitary cancer 1972 6.02895254762241E-5
ovarian cancer 8492 9.14884261079006E-5
interstitial cystitis 2299 3.21246701317909E-4
pancreatic cancer 2300 9.99517031119746E-4
medulloblastoma 1524 0.00162838107551446
gastric cancer 436 0.00275582550008813
dermatomyositis 967 0.00282995044483461
tuberculosis and treatment for 6 months 686 0.00689545972401885
astrocytoma 1493 0.00755369644552455
invasive ductal carcinoma 2950 0.0100240070510407
medulloblastoma, large-cell 6234 0.0108911346120844
Waldenstrons macroglobulinemia 765 0.0155072726533926
osteosarcoma 7933 0.0169048850291636
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0176826703128974
atypical teratoid / rhabdoid tumor 4369 0.0235790724443963
Breast cancer 3099 0.0260219833290876
oligodendroglioma 2849 0.0306376177071967
Rheumatoid Arthritis 1171 0.0463490644429259
interstitial lung disease 292 0.0464585370471579

Expression

  Differential Expression (22)

Synonym

Accession P0DMV8 B4E3B6 P08107 P19790 Q5JQI4 Q5SP17 Q9UQL9 Q9UQM0
Symbols HSP70-2
HSP70.2
HSP70-1B

Gene

PDB

3A8Y   1XQS   1HJO   1S3X   2E88   2E8A   2LMG   3ATU   3ATV   3AY9   3D2E   3D2F   3JXU   3LOF   3Q49   4IO8   4J8F   4PO2   4WV5   4WV7   5AQZ   5AR0   5BN8   5BPL   5BPN  

  Ortholog (1)

Species Source
Chimp OMA EggNOG

 Compartment GO Term (0)

Gene RIF (137)

PMID Text
26745065 Polymorphism of HSP70 A1B gene is associated with the development of esophageal Carcinoma.
26496868 HSPA1B (rs1061581) is associated with a decreased risk of idiopathic pulmonary fibrosis in a Mexican population.
26448330 Lysine methylation of HSPA1 differs between metastatic breast and ovarian carcinoma.
26160076 Infertility in males with normal sperm parameters was not significantly associated with HSPA1B:c.1059G>A gene polymorphism.
25842857 HSPA1B A1267G polymorphism is a marker of susceptibility to peptic ulcer in the Iranian population.
25412654 The G allele of the HSP70-2 A+1267G polymorphism confers survival advantages in non-diabetic peritoneal dialysis patients
25253958 The A allele of the HSP70-2 PstI polymorphism was associated with enterocutaneous fistulas in this Chinese population.
25213699 HSP70-2 plays a key role in cancerous growth and invasive potential of RCC cells.
25169537 This meta-analysis suggests associations between the HSPA1B +/-1267A/G polymorphism and risk of cancer.
24328534 The expression of HSP70-1A and HSP70-1B in T-lymphocytes and monocytes from multiple sclerosis patients under basal conditions was up-regulated that may reflect the immunological activation occurring in these patients.
More...

AA Sequence

MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDA      1 - 70
KRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVT     71 - 140
NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSIL    141 - 210
TIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQA    211 - 280
SLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL    281 - 350
QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI    351 - 420
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA    421 - 490
TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKG    491 - 560
KISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGG    561 - 630
SGSGPTIEEVD                                                               631 - 641
//

Text Mined References (194)

PMID Year Title
26745065 2015 Polymorphisms in Heat Shock Proteins A1B and A1L (HOM) as Risk Factors for Oesophageal Carcinoma in Northeast India.
26496868 2015 Analysis of heat shock protein 70 gene polymorphisms Mexican patients with idiopathic pulmonary fibrosis.
26448330 2015 Hsp70 (HSPA1) Lysine Methylation Status as a Potential Prognostic Factor in Metastatic High-Grade Serous Carcinoma.
26160076 2015 Genetic polymorphisms of hspa1b and hspa1l in infertile men.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25842857 [Anatlysis of HSPA1B A1267G gene polymorphism in peptic ulcer].
25412654 2014 Relationship between HSP70-2 A+1267G Polymorphism and Cardiovascular Events of Chinese Peritoneal Dialysis Patients.
25281747 2014 RING finger protein RNF207, a novel regulator of cardiac excitation.
25253958 2014 Polymorphism of heat shock protein 70-2 and enterocutaneous fistula in Chinese population.
25213699 2014 Targeting the testis-specific heat-shock protein 70-2 (HSP70-2) reduces cellular growth, migration, and invasion in renal cell carcinoma cells.
More...