Property Summary

Ligand Count 4
NCBI Gene PubMed Count 182
PubMed Score 0.00
PubTator Score 112.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytoma 2.300 7.6e-03
atypical teratoid / rhabdoid tumor -1.200 2.4e-02
Breast cancer 3.600 3.0e-02
dermatomyositis 1.100 2.8e-03
gastric cancer 1.100 2.8e-03
group 3 medulloblastoma -1.100 7.1e-03
hepatocellular carcinoma 1.700 7.4e-06
interstitial cystitis -1.600 3.2e-04
interstitial lung disease -1.700 4.6e-02
intraductal papillary-mucinous adenoma (... 1.700 1.8e-02
invasive ductal carcinoma 1.800 1.0e-02
lung cancer -3.700 4.8e-06
medulloblastoma -1.100 1.6e-03
medulloblastoma, large-cell -1.100 2.5e-02
oligodendroglioma -1.900 3.1e-02
osteosarcoma 1.663 1.7e-02
ovarian cancer -1.600 1.9e-02
pancreatic cancer 1.500 9.4e-04
pituitary cancer -1.800 6.0e-05
Rheumatoid arthritis 1.500 4.6e-02
tuberculosis -4.600 7.0e-07
Waldenstrons macroglobulinemia 1.829 1.6e-02

 Compartment GO Term (0)

Gene RIF (141)

AA Sequence

MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDA      1 - 70
KRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVT     71 - 140
NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSIL    141 - 210
TIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQA    211 - 280
SLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL    281 - 350
QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI    351 - 420
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA    421 - 490
TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKG    491 - 560
KISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGG    561 - 630
SGSGPTIEEVD                                                               631 - 641
//

Text Mined References (210)

PMID Year Title