Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.95
PubTator Score 1.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Acute leukemia 15 3.28 1.6

Gene RIF (1)

AA Sequence

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD      1 - 70
SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETAFSPKSQQEINADIKRQLVKELRCVGQK     71 - 140
YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI                         141 - 189
//

Text Mined References (4)

PMID Year Title