Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.95
PubTator Score 1.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Acute leukemia 8 3.262 1.6

Synonym

Accession P0DMV1
Symbols CT45-2
CT45.2

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20920256 CT45A2 is a novel spliced MLL fusion partner in de novo biphenotypic acute leukemia [case report]

AA Sequence

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD      1 - 70
SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETAFSPKSQQEINADIKRQLVKELRCVGQK     71 - 140
YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI                         141 - 189
//

Text Mined References (4)

PMID Year Title
20920256 2010 A novel spliced fusion of MLL with CT45A2 in a pediatric biphenotypic acute leukemia.
15905330 2005 Identification of cancer/testis-antigen genes by massively parallel signature sequencing.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.