Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Acute leukemia 8 3.262 1.6

Synonym

Accession P0DMU7 Q8N7B7
Symbols CT45-6
CT45.6

Gene

 Compartment GO Term (0)

AA Sequence

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD      1 - 70
SQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK     71 - 140
YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI                         141 - 189
//

Text Mined References (3)

PMID Year Title
15905330 2005 Identification of cancer/testis-antigen genes by massively parallel signature sequencing.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.