Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DMU5 A6NEA5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVSSKGLWKERPSAHTSECFSTTACPVAFILLVWNSQTPAGLQSLCTGRHPSLSARAQRAGPRASREEGT      1 - 70
FWTERVGQERWLIRSGSSQNESQEDQGAGLISQAGLKADNRRESSTWANEVEDRRPQCTPALNLTPSHPH     71 - 140
PPHSLTTFLRSVIGIQIPPGLVAAGGTVA                                             141 - 169
//

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.