Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03

Expression

AA Sequence

MDPGNHSSVTESILAGLSEQPELQLRLFLLFLGICVVTVVGNLGMITLIGLSSHLHTPMYYFLSSLSFID      1 - 70
FCHSTVITPKMLVNFATEKNIISYPECMAQLYLFSIFAIAECHMLAAMAYDCYVAICSPLLYNVIMSYHH     71 - 140
CFWLTVGVYILGILGSTIHTSFMLRLFLCKTNVINHYFCDLFPLLGLSCSSTYINELLVLVLSAFNILMP    141 - 210
ALTILASYIFIIASILRIHSTEGRSKAFSTCSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTT    211 - 280
IVPMLNPLIYSLRNKDVKLAVKKILHQTAC                                            281 - 310
//

Text Mined References (3)

PMID Year Title