Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

AA Sequence

MDPGNHSSVTESILAGLSEQPELQLRLFLLFLGICVVTVVGNLGMITLIGLSSHLHTPMYYFLSSLSFID      1 - 70
FCHSTVITPKMLVNFATEKNIISYPECMAQLYLFSIFAIAECHMLAAMAYDCYVAICSPLLYNVIMSYHH     71 - 140
CFWLTVGVYILGILGSTIHTSFMLRLFLCKTNVINHYFCDLFPLLGLSCSSTYINELLVLVLSAFNILMP    141 - 210
ALTILASYIFIIASILRIHSTEGRSKAFSTCSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTT    211 - 280
IVPMLNPLIYSLRNKDVKLAVKKILHQTAC                                            281 - 310
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.