Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma 2.200 0.002
medulloblastoma, large-cell 3.200 0.034
subependymal giant cell astrocytoma -3.273 0.009

Gene RIF (1)

PMID Text
25640239 The human and mouse MLN genes consist of three exons that span 16.5 and 15.0 kb, respectively, with the ORF located in exon 3; findings identify MLN as an important regulator of skeletal muscle physiology.

AA Sequence

MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS                              1 - 46
//

Text Mined References (3)

PMID Year Title
25640239 2015 A micropeptide encoded by a putative long noncoding RNA regulates muscle performance.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.