Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma 2.200 1.8e-03
medulloblastoma, large-cell 3.200 3.4e-02
subependymal giant cell astrocytoma -3.273 8.8e-03

Gene RIF (1)

AA Sequence

MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS                              1 - 46
//

Text Mined References (4)

PMID Year Title