Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
adrenocortical carcinoma 1427 1.20704918033704E-5
group 3 medulloblastoma 2254 1.44277193378822E-5
medulloblastoma, large-cell 6234 1.98826594683165E-4
interstitial cystitis 2299 5.75803648782611E-4
osteosarcoma 7933 8.78740058128046E-4
primitive neuroectodermal tumor 3031 0.00407405024281312
invasive ductal carcinoma 2950 0.00511876226969436
tuberculosis and treatment for 3 months 327 0.00637827858179646
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0175514889942734
oligodendroglioma 2849 0.0187811809136334
ependymoma 2514 0.0203953285858632
atypical teratoid / rhabdoid tumor 4369 0.0227385619080293
mucosa-associated lymphoid tissue lymphoma 480 0.0376110538693861

Expression

AA Sequence

MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMWLFILLSLALI      1 - 70
SDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVT     71 - 140
MSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSR    141 - 210
TSILIICILITGLGIISVISHLTKRRRSQRNRRVGNTLKPFSRVLTPKEMAPTEQM                  211 - 266
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.