Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DMR2
Symbols

Gene

  Ortholog (6)

Species Source
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCR      1 - 70
DGLQPMHKAELVKLLVQVLGSQDGA                                                  71 - 95
//

Text Mined References (3)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
11181995 2001 The sequence of the human genome.
9847074 1998 Toward a complete human genome sequence.