Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MKERDAAPAERGKPATYTGDKKAKMAAKTNKKWVRLATVFAYVLSVSLAAIVLAVYYSLIWQPVGAGTSG      1 - 70
GAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPD     71 - 140
EDEEETAAAPGSR                                                             141 - 153
//

Text Mined References (4)

PMID Year Title