Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DMQ5
Symbols OGU1
LINC00984

Gene

 Compartment GO Term (0)

AA Sequence

MKERDAAPAERGKPATYTGDKKAKMAAKTNKKWVRLATVFAYVLSVSLAAIVLAVYYSLIWQPVGAGTSG      1 - 70
GAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPD     71 - 140
EDEEETAAAPGSR                                                             141 - 153
//

Text Mined References (4)

PMID Year Title
19531736 2009 Transcripts of unknown function in multiple-signaling pathways involved in human stem cell differentiation.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.