Property Summary

NCBI Gene PubMed Count 3
PubMed Score 21.35
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.500 0.000

Synonym

Accession P0DMP2
Symbols SRGAP2L
SRGAP2P2

Gene

AA Sequence

MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKL      1 - 70
AERFLAKTCSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFK     71 - 140
KSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDST    141 - 210
ANVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDCCD    211 - 280
LGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGD    281 - 350
MASQLCAQQPVQSELLQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMES    351 - 420
VKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF                                    421 - 458
//

Text Mined References (4)

PMID Year Title
22559944 2012 Inhibition of SRGAP2 function by its human-specific paralogs induces neoteny during spine maturation.
22559943 2012 Evolution of human-specific neural SRGAP2 genes by incomplete segmental duplication.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.