Property Summary

NCBI Gene PubMed Count 3
PubMed Score 24.74
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.500 1.6e-17

Synonym

Accession P0DMP2
Symbols SRGAP2L
SRGAP2P2

Gene

PANTHER Protein Class (2)

 GO Component (1)

AA Sequence

MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKL      1 - 70
AERFLAKTCSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFK     71 - 140
KSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPRSPDST    141 - 210
ANVRIEEKHVRRSSVKKIEKMKEKRQAKYTENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDCCD    211 - 280
LGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGD    281 - 350
MASQLCAQQPVQSELLQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMES    351 - 420
VKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF                                    421 - 458
//

Text Mined References (4)

PMID Year Title