Property Summary

NCBI Gene PubMed Count 60
PubMed Score 201.61
PubTator Score 637.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0DMN0 B4DNV0 O95603 P50224 Q1ET66 Q6ZWJ5 ST1A4
Symbols STM
HAST
HAST3
M-PST
ST1A3
ST1A5
TL-PST
ST1A3/ST1A4

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (22)

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC      1 - 70
NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY     71 - 140
HFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF    141 - 210
VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY    211 - 280
AEKMAGCSLSFRSEL                                                           281 - 295
//

Text Mined References (62)

PMID Year Title