Property Summary

NCBI Gene PubMed Count 60
PubMed Score 201.61
PubTator Score 637.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC      1 - 70
NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY     71 - 140
HFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF    141 - 210
VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY    211 - 280
AEKMAGCSLSFRSEL                                                           281 - 295
//

Text Mined References (62)

PMID Year Title