Property Summary

NCBI Gene PubMed Count 57
Grant Count 29
R01 Count 12
Funding $4,437,144.41
PubMed Score 249.09
PubTator Score 637.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26611713 Sulfate metabolites R-6-S and R-4'-S were generated from raloxifene in SULT293 expression HEK293 cells. Cellular excretion of the raloxifene sulfates was mainly mediated by BCRP and MRP4.
26291395 This study aimed to establish SULT1A3 stably transfected HEK293 cells, and to determine the contributions of BCRP and MRP transporters to excretion of chrysin and apigenin sulfates.
26067475 A systematic analysis showed that three of the twelve human SULTs, SULT1A1, SULT1A3 and SULT1C4, displayed the strongest sulphating activity towards acetaminophen.
25941087 Genetic polymorphism of SULT1A3,a major ritodrine-sulfating SULT, appeared to exert a dramatic effect on the sulfating activity of SULT1A3 allozymes.
24692077 The common SULT1A3 single-nucleotide polymorphism 105A>G is not an important determinant of salbutamol enantiomer pharmacokinetics under normal clinical use and does not place some individuals at greater risk of accumulation in the body.
24136195 Taken together, these results show that dopamine can induce its own metabolism and protect neuron-like cells from damage, suggesting that SULT1A3 activity may be a risk factor for dopamine-dependent neurodegenerative diseases.
24039991 Data indicate that protein-ligand interaction energy by using docking Quantitative Structure-Activity Relationships(QSAR) models showed accuracy of 67.28%, 78.00% and 75.46%, for the isoforms SULT1A1, SULT1A3 and SULT1E1, respectively.
22949271 The expression of ALDOA and/or SULT1A3 is significantly higher.
22352375 Studies indicate that SULT1A3 is the main isoform responsible for flavonoid sulfonation in the Caco-2 cells.
21168432 SULT1A3 has a role in the inactivation of excess chlorotyrosine and nitrotyrosine during inflammation in lung endothelial and epithelial cells.
More...

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC      1 - 70
NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY     71 - 140
HFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF    141 - 210
VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY    211 - 280
AEKMAGCSLSFRSEL                                                           281 - 295
//

Text Mined References (59)

PMID Year Title
26611713 2015 Sulfonation of raloxifene in HEK293 cells overexpressing SULT1A3: Involvement of breast cancer resistance protein (BCRP/ABCG2) and multidrug resistance-associated protein 4 (MRP4/ABCC4) in excretion of sulfate metabolites.
26291395 2015 Efflux transport of chrysin and apigenin sulfates in HEK293 cells overexpressing SULT1A3: The role of multidrug resistance-associated protein 4 (MRP4/ABCC4).
26067475 2015 Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.
25941087 2015 Sulfation of ritodrine by the human cytosolic sulfotransferases (SULTs): Effects of SULT1A3 genetic polymorphism.
25416956 2014 A proteome-scale map of the human interactome network.
24692077 2015 SULT 1A3 single-nucleotide polymorphism and the single dose pharmacokinetics of inhaled salbutamol enantiomers: are some athletes at risk of higher urine levels?
24136195 2013 Cytosolic sulfotransferase 1A3 is induced by dopamine and protects neuronal cells from dopamine toxicity: role of D1 receptor-N-methyl-D-aspartate receptor coupling.
24039991 2013 In silico mechanistic profiling to probe small molecule binding to sulfotransferases.
22949271 2014 Proteomic profiling of osteosarcoma cells identifies ALDOA and SULT1A3 as negative survival markers of human osteosarcoma.
22352375 2012 SULT1A3-mediated regiospecific 7-O-sulfation of flavonoids in Caco-2 cells can be explained by the relevant molecular docking studies.
More...