Property Summary

NCBI Gene PubMed Count 26
Grant Count 16
R01 Count 8
Funding $1,185,782.97
PubMed Score 824.72
PubTator Score 1132.43

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
22387044 results are consistent with a pleiotropic effect of placental hGH/CSH genes at the maternal-fetal interface relating to the regulation of fetal growth and the risk of affected maternal metabolism.
21737519 Data conclude that members of the C/EBP and Ets families can differentially modulate CS-Benh and CS-Aenh activity.
15531513 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12703979 Cpn10 and placental lactogen are capable of stimulating the synthesis of type I collagen by human osteoblasts in culture

AA Sequence

MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF      1 - 70
LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL     71 - 140
KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (28)

PMID Year Title
26862561 2016 Curated eutherian third party data gene data sets.
26697363 2015 Third party data gene data set of eutherian growth hormone genes.
22387044 2012 Differential placental expression profile of human Growth Hormone/Chorionic Somatomammotropin genes in pregnancies with pre-eclampsia and gestational diabetes mellitus.
21737519 2011 Identification of functional CCAAT/enhancer-binding protein and Ets protein binding sites in the human chorionic somatomammotropin enhancer sequences.
18473352 2008 Complex signatures of locus-specific selective pressures and gene conversion on Human Growth Hormone/Chorionic Somatomammotropin genes.
16546209 2006 Crystal structure and site 1 binding energetics of human placental lactogen.
15531513 2004 Late life metabolic syndrome, early growth, and common polymorphism in the growth hormone and placental lactogen gene cluster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
12703979 2002 Type I collagen synthesis by human osteoblasts in response to placental lactogen and chaperonin 10, a homolog of early-pregnancy factor.
More...