Property Summary

NCBI Gene PubMed Count 26
PubMed Score 830.60
PubTator Score 1132.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer -7.000 3.0e-19

Gene RIF (4)

AA Sequence

MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF      1 - 70
LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL     71 - 140
KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (28)

PMID Year Title